PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.U2LLP
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ZF-HD
Protein Properties Length: 69aa    MW: 7436.51 Da    PI: 9.5456
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.U2LLPgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer85.17.6e-27653957
  ZF-HD_dimer  9 ClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                    NhAa+ Gg+avDGC+Efm+s  +egt+ al+CaACgCHRnFHRr++
  Araip.U2LLP  6 VVMNHAANSGGYAVDGCREFMAS-AAEGTTGALTCAACGCHRNFHRRKE 53
                 567*******************9.8889*******************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5152320.811352IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.7E-25653IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.4E-22852IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-15952IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MKKRQVVMNH AANSGGYAVD GCREFMASAA EGTTGALTCA ACGCHRNFHR RKELAAPSRD  60
LTFKAVINH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016192265.18e-32PREDICTED: mini zinc finger protein 3 isoform X1
RefseqXP_016192269.19e-32PREDICTED: mini zinc finger protein 3 isoform X2
SwissprotQ9CA512e-21MIF1_ARATH; Mini zinc finger protein 1
TrEMBLG7IXD42e-23G7IXD4_MEDTR; Mini zinc finger protein
STRINGGLYMA05G01060.12e-22(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2903722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.11e-22mini zinc finger 1